count {seqinr} | R Documentation |
Counts the number of times dimer/trimer/etc oligomers occur in a sequence. Note that the oligomers are overlapping by default.
count(seq, wordsize, start = 0, by = 1, freq = FALSE, alphabet = s2c("acgt"), frame = start)
seq |
a vector of single characters. |
wordsize |
an integer giving the size of word (n-mer) to count. |
start |
an integer (0, 1, 2,...) giving the starting position to consider in the sequence. The default value 0 means that we start at the first nucleotide in the sequence. |
by |
an integer defaulting to 1 for the window step. |
freq |
if TRUE, word relative frequencies (summing to 1) are returned instead of counts |
alphabet |
a vector of single characters used to build the oligomer set. |
frame |
synonymous for start |
count
counts the occurence of all words by moving a window of
length word
. The window step is controlled by the argument by
.
start
controls the starting position in the sequence for the count.
This function returns a table
whose dimnames
are all the possible
oligomers. All oligomers are returned, even if absent from
the sequence.
D. Charif, J.R. Lobry with suggestions from Gabriel Valiente, Stefanie Hartmann and Christian Gautier
citation("seqinr")
table
for the class of the returned objet. See rho
and
zscore
for dinucleotide statistics.
a <- s2c("acgggtacggtcccatcgaa") ## ## To count dinucleotide occurrences in sequence a: ## count(a, word = 2) ## ## To count trinucleotide occurrences in sequence a, with start = 2: ## count(a, word = 3, start = 2) ## ## To count dinucleotide relative frequencies in sequence a: ## count(a, word = 2, freq = TRUE) ## ## To count dinucleotides in codon positions III-I in a coding sequence: ## alldinuclIIIpI <- s2c("NNaaNatNttNtgNgtNtcNctNtaNagNggNgcNcgNgaNacNccNcaNN") resIIIpI <- count(alldinuclIIIpI, word = 2, start = 2, by = 3) stopifnot(all( resIIIpI == 1)) ## ## Simple sanity check: ## #alldinucl <- "aattgtctaggcgacca" #stopifnot(all(count(s2c(alldinucl), 2) == 1)) #alldiaa <- "aaxxzxbxvxyxwxtxsxpxfxmxkxlxixhxgxexqxcxdxnxrxazzbzvzyzwztzszpzfzmzkzlzizhzgzezqzczdznz #rzabbvbybwbtbsbpbfbmbkblbibhbgbebqbcbdbnbrbavvyvwvtvsvpvfvmvkvlvivhvgvevqvcvdvnvrvayywytysypyfymyky #lyiyhygyeyqycydynyryawwtwswpwfwmwkwlwiwhwgwewqwcwdwnwrwattstptftmtktltithtgtetqtctdtntrtasspsfsmsks #lsishsgsesqscsdsnsrsappfpmpkplpiphpgpepqpcpdpnprpaffmfkflfifhfgfefqfcfdfnfrfammkmlmimhmgmemqmcmdmnm #rmakklkikhkgkekqkckdknkrkallilhlglelqlcldlnlrlaiihigieiqicidiniriahhghehqhchdhnhrhaggegqgcgdgngrgae #eqecedenereaqqcqdqnqrqaccdcncrcaddndrdannrnarra" #stopifnot(all(count(s2c(alldiaa), 2, alphabet = s2c("arndcqeghilkmfpstwyvbzx")) == 1)) ## ## Example with dinucleotide count in the complete Human mitochondrion genome: ## humanMito <- read.fasta(file = system.file("sequences/humanMito.fasta", package = "seqinr")) ## ## Get the dinucleotide count: ## dinu <- count(humanMito[[1]], 2) ## ## Put the results in a 4 X 4 array: ## dinu2 <- dinu dim(dinu2) <- c(4, 4) nucl <- s2c("ACGT") dimnames(dinu2) <- list(paste(nucl, "-3\'", sep = ""), paste("5\'-", nucl, sep = "")) ## ## Show that CpG and GpT dinucleotides are depleted: ## mosaicplot(t(dinu2), shade = TRUE, main = "Dinucleotide XpY frequencies in the Human\nmitochondrion complete genome", xlab = "First nucleotide: Xp", ylab = "Second nucleotide: pY", las = 1, cex = 1) mtext("Note the depletion in CpG and GpT dinucleotides", side = 1, line = 3)